S0qxmvv458: Новая страница: «Biological sequences variety the bedrock of innovation in biotechnology, with many advancements revolving all-around these sequences. Having said that, the distin...»

2023-07-24T12:07:27Z

Новая страница: «Biological sequences variety the bedrock of innovation in biotechnology, with many advancements revolving all-around these sequences. Having said that, the distin...»

Новая страница

Biological sequences variety the bedrock of innovation in biotechnology, with many advancements revolving all-around these sequences. Having said that, the distinctive character of Organic sequences poses a problem for common search phrase-based mostly facts retrieval strategies, generally bringing about the oversight of essential information and opportunity risks.

The sequences introduced in patent claims encompass a wide range of variants, not merely describing the sequences them selves but will also demanding a selected degree of homology. Due to this fact, scientists intensely rely on homology sequence alignment algorithms to discover sequence databases, making use of predefined homology thresholds to be sure comprehensive success. This approach is commonly utilized in present biological sequence databases lookups.

Nevertheless, a urgent query continues to be: can these very similar sequence lookups genuinely establish all possible concentrate on sequences? Although these methods have confirmed helpful, their capability to seize each individual relevant sequence warrants additional examination. It can be important to explore the limitations of existing search methodologies and strive for Increased methods that depart no opportunity target sequence undiscovered. 

Particular Sequences in Patents 

Combining very similar sequence lookups with key phrase dependent results aggregation substantially cuts down the risk of overlooking very important information and facts and FTO concerns.

Having said that, sequences in patents vary from All those located in other Organic databases since they show many “patent-precise” traits. To expand the scope of patent safety and develop look for obstacles for opponents, patent drafters usually use a description system comparable to the “Markush construction” Employed in chemistry. By introducing degenerate symbols, wildcards, operators, and also other information between positions during the guardian sequence, and describing the precise parameters of these [https://eureka.patsnap.com/patent-US20200227985A1 Implement storage] symbols as a result of explanatory files, we check with them as “Degenerate Sequences.”

The impression beneath illustrates a degenerate sequence explained in patent statements: 

Degenerate sequences on their own don't possess any Organic importance; they exclusively serve the objective of the patent. Nonetheless, when coupled with The outline with the homology vary, these kinds of an solution not merely comprehensively protects progressive achievements but in addition will become a “decisive blow” against The existing typical sequence homology look for solutions.  Allow’s Look into an instance beneath.

Question sequence:

“EVGSYPAPSDACPSDYFYCDASGRSAGGGGTENLYFQGSGGS” 

Concentrate on sequence: 

“EVGSYXXXXXXCXXXXXXCXXSGRSAGGGG TENLYFQGSG GS” 

The similarity rating received from the BLAST algorithm is only 67%, but the actual similarity is 100%. 

This happens because typical [https://eureka.patsnap.com/patent-US20190268741A1 Alocasia] sequence homology alignment algorithms do not take into account scenarios involving degenerate sequences throughout their initial [https://eureka.patsnap.com/patent-CN112751801A Standard definition] progress. For that reason, without the need of Unique processing, excluding degenerate sequences would bring on two circumstances when working with conventional algorithms: 

1) Lack of ability to look for the sequence

2) Exclusion of sequences resulting from similarity scores falling underneath the brink. 

The two eventualities pose significant challenges for sequence searchers, as they don't just impede the comparison of sequences with patent statements but will also raise the chance of overlooking vital sequence details. 

Patsnap’s Solution

Patsnap’s biological sequence database (Bio) stats exhibit which the incidence of these types of Specific sequences in world patent literature will not be insignificant. You can find close to 7.four million nucleotide sequences, accounting for seven.12% [https://eureka.patsnap.com/patent-US20050144553A1 Actin] of [https://eureka.patsnap.com/patent-US20120032822A1 Pyruvate carboxylase] the whole variety of nucleotides, and one.31 million protein sequences, accounting for 7.55%. This means a big number of generic sequences that can have an impact on search engine results due to the existence of Exclusive symbols, posing sizeable threats for FTO analyses. 

Consequently, to mitigate the potential risk of overlooking these crucial sequences, Patsnap’s Algorithm Engineering Group has created a deep Mastering product applying in-household NLP, CV, entity recognition, and coreference resolution technologies.

This design is designed to recognize and parse degenerate sequences and their substitutions in sequence listings and whole-text patents, and it founded a Degenerate Sequence Seeking Databases as Portion of our Bio Qualified package.

Using a specialized sequence alignment algorithm, this database not just permits the retrieval of this kind of sequences and also delivers a real similarity score. Hence, by undertaking queries in the degenerate sequence database, we are able to effectively mitigate the potential risk of inadvertently overlooking important facts for the duration of liberty to operate (FTO) and novelty lookups.

Presented the probable scale of variants in degenerate sequences, which often can reach the tens of billions, standard sequence alignment algorithms are unsuccessful to satisfy the real-time retrieval demands. Patsnap tackles this obstacle by utilizing a deeply custom made sequence alignment algorithm that dynamically hundreds substitution information and facts for degenerate sequences in the course of the retrieval procedure, ensuring exact retrieval within affordable time frames.

Over the scanning period, Patsnap introduces a compression algorithm to construct a seed term desk for heuristic queries, significantly cutting down avoidable comparisons and bettering retrieval efficiency. When aligning query sequences with concentrate on sequences, Patsnap’s proprietary algorithm incorporates degenerate substitution data, causing much more exact alignment and question outcomes, along with far more intuitive and visually desirable alignment outcomes for various variants on the query sequence and goal sequence.

Working experience Degenerate Sequence Looking Now

In June of 2023, Patsnap’s biological sequence Bio databases introduced a powerful degenerate sequence lookup aspect, creating a paradigm change in the patent area. This disruptive progression delivers scientists with an immensely strong Device that gives an extensive collection of degenerate sequences, allowing customers to easily get essentially the most precise and appropriate info in their queries.

To schedule a demo or learn more, go to patsnap.com/solutions/bio.

About Patsnap: Launched in 2007, Patsnap is the business at the rear of the whole world’s main AI-powered innovation intelligence System. Patsnap supplies worldwide corporations which has a connected, effortless-to-use System that can help them make greater choices from the innovation procedure. Customers are innovators throughout various industry sectors, including agriculture and substances, client merchandise, food items and beverage, life sciences, automotive, oil and gasoline, Experienced providers, aviation and aerospace, and education and learning.

Supercharging FTO Search with Degenerate Sequence Searching 95463 - История изменений

S0qxmvv458: Новая страница: «Biological sequences variety the bedrock of innovation in biotechnology, with many advancements revolving all-around these sequences. Having said that, the distin...»