Supercharging FTO Search with Degenerate Sequence Searching

2023-07-13T11:00:54Z

C3bfmen576: Новая страница: «Biological sequences variety the bedrock of innovation in biotechnology, with numerous developments revolving all around these sequences. However, the special nat...»

Biological sequences variety the bedrock of innovation in biotechnology, with numerous developments revolving all around these sequences. However, the special nature of biological sequences poses a obstacle for standard search phrase-based information retrieval methods, normally leading to the oversight of essential info and potential pitfalls.

The sequences introduced in patent promises encompass a wide range of variants, not merely describing the sequences them selves but will also necessitating a selected standard of homology. Therefore, scientists heavily trust in homology sequence alignment algorithms to investigate sequence databases, making use of predefined homology thresholds to guarantee extensive effects. This method is greatly used in present biological sequence database searches.

Nevertheless, a urgent issue remains: can these equivalent sequence searches genuinely recognize all prospective target sequences? While these techniques have proven efficient, their capacity to seize each relevant sequence warrants even more examination. It is essential to check out the constraints of present look for methodologies and try for Increased techniques that go away no prospective focus on sequence undiscovered. 

Specific Sequences in Patents 

Combining equivalent sequence lookups with key phrase based success aggregation considerably decreases the chance of overlooking critical details and FTO problems.

Nevertheless, sequences in patents differ from Individuals present in other Organic databases as they show numerous “patent-unique” traits. To expand the scope of patent security and create look for limitations for opponents, patent drafters generally use an outline strategy just like the “Markush construction” Employed in chemistry. By introducing degenerate symbols, wildcards, operators, and also other details in between positions while in the father or mother sequence, and describing the precise parameters of these symbols by way of explanatory paperwork, we check with them as “Degenerate Sequences.”

The picture below illustrates a degenerate sequence explained in patent statements: 

Degenerate sequences them selves don't possess any biological significance; they only serve the objective of the patent. However, when combined with the description from the homology selection, these kinds of an method don't just comprehensively guards modern achievements but will also will become a “decisive blow” from the current standard sequence homology look for techniques.  Allow’s Examine an illustration under.

Question sequence:

“EVGSYPAPSDACPSDYFYCDASGRSAGGGGTENLYFQGSGGS” 

Focus on sequence: 

“EVGSYXXXXXXCXXXXXXCXXSGRSAGGGG TENLYFQGSG GS” 

The similarity rating attained from the BLAST algorithm is barely 67%, but the actual similarity is one hundred%. 

This takes place mainly because standard sequence homology alignment algorithms don't contemplate scenarios involving degenerate sequences in the course of their initial improvement. As a result, without having Specific processing, excluding degenerate sequences would produce two predicaments when utilizing common algorithms: 

one) Incapacity to find the sequence

two) Exclusion of sequences as a consequence of similarity scores slipping down below the edge. 

Both equally scenarios pose important difficulties for sequence searchers, as they not merely impede the comparison of sequences with patent promises but also raise the probability of overlooking critical sequence info. 

Patsnap’s Resolution

Patsnap’s Organic sequence databases (Bio) figures present that the event of this sort of special sequences in world patent literature is not really insignificant. There are actually about 7.4 million nucleotide sequences, accounting for 7.12% of the overall quantity of nucleotides, and one.31 million protein sequences, accounting for seven.55%. This indicates a substantial variety of generic sequences that can have an affect on search engine results due to presence of special symbols, posing significant challenges for FTO analyses.  Therefore, [https://eureka.patsnap.com/patent-US20030121949A1 Avoid modification] to mitigate the chance of overlooking these crucial sequences, Patsnap’s Algorithm Engineering Team has formulated a deep Studying product employing in-property NLP, CV, entity recognition, and coreference resolution systems.

This product is designed to establish and parse degenerate sequences as well as their substitutions in sequence listings and complete-text patents, and it proven a Degenerate Sequence Hunting Databases as part of our Bio Specialist bundle.

Using a specialized sequence alignment algorithm, this database not simply enables the retrieval of such sequences but in addition supplies a real similarity rating. As a result, by performing queries in the degenerate sequence database, we can properly mitigate the chance of inadvertently overlooking vital information and facts during flexibility to function (FTO) and novelty searches.

Supplied the prospective scale of variants in degenerate sequences, which could reach the tens of billions, classic sequence alignment algorithms fail to meet the real-time retrieval calls for. Patsnap tackles this challenge by employing a deeply custom made sequence alignment algorithm that dynamically loads substitution information and facts for degenerate sequences in the retrieval process, ensuring precise retrieval within just realistic time frames.

In the course of the scanning phase, Patsnap introduces a compression algorithm to [https://eureka.patsnap.com/patent-CN108436342A Increase bone density] build a seed term table [https://eureka.patsnap.com/patent-CN112958690A Good segmentation effect] for heuristic searches, considerably cutting down unneeded comparisons and enhancing retrieval effectiveness. When aligning query sequences with concentrate on sequences, Patsnap’s proprietary algorithm incorporates degenerate substitution information and facts, causing much more exact alignment and query success, together with much more intuitive and visually pleasing alignment results for different variants of the query sequence and focus on sequence.

Knowledge Degenerate Sequence Browsing Now

In June of 2023, Patsnap’s Organic sequence Bio database launched a robust degenerate sequence research function, creating a paradigm shift from the patent area. This disruptive development presents scientists by having an immensely sturdy Resource that gives an intensive collection of degenerate sequences, permitting people to effortlessly receive probably the most accurate and pertinent facts within their searches.

To agenda a demo or learn more, take a look at patsnap.com/alternatives/bio.

About Patsnap: Started in 2007, Patsnap is the corporate behind the planet’s foremost AI-driven innovation intelligence System. Patsnap gives global companies by using a linked, quick-to-use System that helps them make greater selections inside the innovation procedure. Consumers are innovators across many field sectors, like agriculture and chemicals, shopper goods, foods and beverage, life sciences, automotive, oil and fuel, Experienced companies, aviation and aerospace, and education and learning.

JD Edwards E1 - Вклад участника [ru]

Supercharging FTO Search with Degenerate Sequence Searching